Iright
BRAND / VENDOR: Proteintech

Proteintech, 66673-1-Ig, ATP5D Monoclonal antibody

CATALOG NUMBER: 66673-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATP5D (66673-1-Ig) by Proteintech is a Monoclonal antibody targeting ATP5D in WB, IHC, ELISA applications with reactivity to Human samples 66673-1-Ig targets ATP5D in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The mitochondrial F1Fo-ATP synthase complex uses energy derived from a proton gradient to synthesize ATP. The ATP5D gene encodes the delta subunit of the mitochondrial ATP synthase F1 complex and belongs to the ATPase epsilon chain family. This gene encode the full length protein of 17 kDa with a transit peptide of 22 amino acid. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7016 Product name: Recombinant human ATP5D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-168 aa of BC002389 Sequence: MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE Predict reactive species Full Name: ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC002389 Gene Symbol: ATP5D Gene ID (NCBI): 513 RRID: AB_2882027 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P30049 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924