Iright
BRAND / VENDOR: Proteintech

Proteintech, 66680-1-Ig, TMEM173/STING Monoclonal antibody

CATALOG NUMBER: 66680-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM173/STING (66680-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM173/STING in WB, IHC, IF-P, ELISA applications with reactivity to human, rat samples 66680-1-Ig targets TMEM173/STING in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HSC-T6 cells, HEK-293 cells, THP-1 cells, MOLT-4 cells, Jurkat cells Positive IHC detected in: human tonsillitis tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Stimulator of interferon genes (STING, also known as ERIS, MITA and MPYS, and encoded by TMEM173) is a transmembrane adaptor protein that facilitates innate immune signaling (PMID: 18724357). STING is widely expressed in various cell types such as endothelial cells, epithelial cells, T cells, macrophages, and dendritic cells (PMID: 26603901). It is predominantly located in the endoplasmic reticulum (ER). STING functions as a sensor of cytosolic DNA and promotes the production of type I interferons and pro-inflammatory cytokines. STING is a 379 amino acid protein with a calculated molecular weight of 42 kDa. It has been observed at 35-40 kDa (PMID: 27324217; 29632140; 30918080), and 70-80 kDa corresponding to the expected size of a STING dimer (PMID: 25790474; 29491158). Specification Tested Reactivity: human, rat Cited Reactivity: human, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20363 Product name: Recombinant human TMEM173 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 174-379 aa of BC047779 Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS Predict reactive species Full Name: transmembrane protein 173 Calculated Molecular Weight: 379 aa, 42 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC047779 Gene Symbol: STING Gene ID (NCBI): 340061 RRID: AB_2882034 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86WV6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924