Iright
BRAND / VENDOR: Proteintech

Proteintech, 66697-1-Ig, ABCD3 Monoclonal antibody

CATALOG NUMBER: 66697-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ABCD3 (66697-1-Ig) by Proteintech is a Monoclonal antibody targeting ABCD3 in WB, ELISA applications with reactivity to Human samples 66697-1-Ig targets ABCD3 in WB, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HT-29 cells, Caco-2 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:2000 Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG3 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24760 Product name: Recombinant human ABCD3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-124 aa of BC068509 Sequence: MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKR Predict reactive species Full Name: ATP-binding cassette, sub-family D (ALD), member 3 Observed Molecular Weight: 70 kDa GenBank Accession Number: BC068509 Gene Symbol: ABCD3 Gene ID (NCBI): 5825 RRID: AB_2882050 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P28288 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924