Iright
BRAND / VENDOR: Proteintech

Proteintech, 66717-1-Ig, STAT6 Monoclonal antibody

CATALOG NUMBER: 66717-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STAT6 (66717-1-Ig) by Proteintech is a Monoclonal antibody targeting STAT6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 66717-1-Ig targets STAT6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, NIH/3T3 cells, HSC-T6 cells, RAW 264.7 cells, K-562 cells, Jurkat cells Positive IHC detected in: human appendicitis tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information STAT6, also named as Signal transducer and activator of transcription 6, is a 847 amino acid protein, which belongs to the transcription factor STAT family. STAT6 forms a homodimer or a heterodimer with a related family member. STAT6 translocates into the nucleus in response to phosphorylation. STAT6 is Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0410 Product name: Recombinant human STAT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 368-567 aa of BC005823 Sequence: IKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDNNAKATILWYNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSE Predict reactive species Full Name: signal transducer and activator of transcription 6, interleukin-4 induced Calculated Molecular Weight: 100 kDa Observed Molecular Weight: 95 kDa GenBank Accession Number: BC005823 Gene Symbol: STAT6 Gene ID (NCBI): 6778 RRID: AB_2882068 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P42226 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924