Proteintech, 66727-1-Ig, Cytokeratin 5 Monoclonal antibody

Size: 20ul / 150ul The Cytokeratin 5 (66727-1-Ig) by Proteintech is a Monoclonal antibody targeting Cytokeratin 5 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, pig samples 66727-1-Ig targets Cytokeratin 5 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: HaCaT cells, SKOV-3 cells, mouse skin tissue, MCF-7 cells, A549 cells, A-253 cells, A431 cells, human saliva, pig skin tissue Positive IHC detected in: human tonsillitis tissue, human breast cancer tissue, human breast hyperplasia tissue, human cervical cancer tissue, human lung cancer tissue, human oesophagus cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human oesophagus cancer tissue, human prostate cancer tissue, human lung cancer tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18). Keratin 5, one 58-kD type II keratin, is coexpressed with a 50-kD keratin 14 in stratified squamous epithelia. Keratin 5, one 58-kD type II keratin, is coexpressed with a 50-kD tyK14 in stratified squamous epithelia. Specification Tested Reactivity: human, mouse, pig Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24184 Product name: Recombinant human KRT5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 316-491 aa of BC024292 Sequence: THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI Predict reactive species Full Name: keratin 5 Calculated Molecular Weight: 590 aa, 62 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC024292 Gene Symbol: Cytokeratin 5 Gene ID (NCBI): 3852 RRID: AB_2882077 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P13647 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.