Iright
BRAND / VENDOR: Proteintech

Proteintech, 66769-1-Ig, PYGL Monoclonal antibody

CATALOG NUMBER: 66769-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PYGL (66769-1-Ig) by Proteintech is a Monoclonal antibody targeting PYGL in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 66769-1-Ig targets PYGL in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, HeLa cells, HepG2 cells, L02 cells, SMMC-7721 cells Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Glycogen phosphorylase L (PYGL) is one of the gene related to hypoxia metabolism and was found to be up-regulated in head and neck squamous cell carcinomas (HNSCCs) and breast cancers. Glycogen synthases (GSs) and glycogen phosphorylases (GPs) catalyze the key steps of glycogen synthesis and breakdown, while glycogen phosphorylase has three isoforms: PYGM (muscle), PYGL (liver), and PYGB (brain) (PMID: 37063425, 9529348). High PYGL expression plays an independent role in predicting the poor prognosis of glioma patients (PMID: 34177761). Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8550 Product name: Recombinant human PYGL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 499-846 aa of BC009895 Sequence: GLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNESNKVNGN Predict reactive species Full Name: phosphorylase, glycogen, liver Calculated Molecular Weight: 846 aa, 97 kDa Observed Molecular Weight: 97 kDa GenBank Accession Number: BC009895 Gene Symbol: PYGL Gene ID (NCBI): 5836 RRID: AB_2882115 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P06737 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924