Product Description
Size: 20ul / 150ul
The CD52 (66784-1-Ig) by Proteintech is a Monoclonal antibody targeting CD52 in WB, ELISA applications with reactivity to human samples
66784-1-Ig targets CD52 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human spleen tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Specification
Tested Reactivity: human
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag17788 Product name: Recombinant human CD52 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-61 aa of BC000644 Sequence: QTGLSGQNDTSQTSSPSASSSMSGGIFLFFVANAIIHLFCFS Predict reactive species
Full Name: CD52 molecule
Calculated Molecular Weight: 6 kDa
Observed Molecular Weight: 20 kDa
GenBank Accession Number: BC000644
Gene Symbol: CD52
Gene ID (NCBI): 1043
RRID: AB_2882129
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: P31358
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924