Iright
BRAND / VENDOR: Proteintech

Proteintech, 66786-1-Ig, SOX10 Monoclonal antibody

CATALOG NUMBER: 66786-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SOX10 (66786-1-Ig) by Proteintech is a Monoclonal antibody targeting SOX10 in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66786-1-Ig targets SOX10 in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, MDA-MB-453 cells Positive IHC detected in: human malignant melanoma tissue, mouse brain tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue, mouse brain tissue Positive IF-Fro detected in: mouse brain tissue Positive FC (Intra) detected in: C6 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit, chicken Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23191 Product name: Recombinant human SOX10 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 267-466 aa of BC002824 Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP Predict reactive species Full Name: SRY (sex determining region Y)-box 10 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC002824 Gene Symbol: SOX10 Gene ID (NCBI): 6663 RRID: AB_2882131 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P56693 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924