Iright
BRAND / VENDOR: Proteintech

Proteintech, 66788-1-Ig, Properdin/PFC Monoclonal antibody

CATALOG NUMBER: 66788-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Properdin/PFC (66788-1-Ig) by Proteintech is a Monoclonal antibody targeting Properdin/PFC in WB, ELISA applications with reactivity to human, rat, pig samples 66788-1-Ig targets Properdin/PFC in WB, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: Jurkat cells, human plasma Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information CFP, also named as Properdin or PFC, is a 469 amino acid protein, which contains 7 TSP type-1 domains. CFP as secreted protein is a positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes. Properdin deficiency poses a significant risk for severe meningococcal infections (PMID: 22229731). Properdin may be novel biomarker for future risk of type 2 diabetes (PMID: 22338105). In plasma, properdin exists as dimers, trimers or tetramers. Specification Tested Reactivity: human, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9798 Product name: Recombinant human CFP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 120-469 aa of BC015756 Sequence: LEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL Predict reactive species Full Name: complement factor properdin Calculated Molecular Weight: 469 aa, 51 kDa Observed Molecular Weight: 50 kDa, 100 kDa, 150 kDa GenBank Accession Number: BC015756 Gene Symbol: CFP Gene ID (NCBI): 5199 RRID: AB_2882133 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P27918 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924