Iright
BRAND / VENDOR: Proteintech

Proteintech, 66793-1-Ig, COMP Monoclonal antibody

CATALOG NUMBER: 66793-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COMP (66793-1-Ig) by Proteintech is a Monoclonal antibody targeting COMP in WB, IF/ICC, ELISA applications with reactivity to human, pig samples 66793-1-Ig targets COMP in WB, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig cartilage tissue Positive IF/ICC detected in: HepG2 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information COMP is a secreted pentameric glycoprotein built from modular units and belongs to the thrombospondin protein family. COMP is expressed by hypertrophic chondrocytes and osteoblasts during endochondral ossification, and its expression is increased during fracture healing. COMP is involved in the assembly of collagen fibrils and other structural matrix components. COMP interacts with a number of cartilage ECM proteins, including fibronectin, collagen I, II IX, XII, and XIV, matrilins, as well as proteoglycans such as aggrecan and others. This antibody got 100-130 kDa maybe due to glycosylation. Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4575 Product name: Recombinant human COMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 407-757 aa of BC033676 Sequence: DNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA Predict reactive species Full Name: cartilage oligomeric matrix protein Calculated Molecular Weight: 757 aa, 83 kDa Observed Molecular Weight: 100-130 kDa GenBank Accession Number: BC033676 Gene Symbol: COMP Gene ID (NCBI): 1311 RRID: AB_2882137 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P49747 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924