Iright
BRAND / VENDOR: Proteintech

Proteintech, 66794-1-Ig, p57Kip2 Monoclonal antibody

CATALOG NUMBER: 66794-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The p57Kip2 (66794-1-Ig) by Proteintech is a Monoclonal antibody targeting p57Kip2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 66794-1-Ig targets p57Kip2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, HCT 116 cells, HeLa cells, MDA-MB-231 cells, NIH/3T3 cells, RAW 264.7 cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information CDKN1C, also named as p57KIP2 and KIP2, belongs to the CDI family. CDKN1C is a potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. It is a negative regulator of cell proliferation. CDKN1C may play a role in maintenance of the non-proliferative state throughout life. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19927 Product name: Recombinant human CDKN1C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-316 aa of BC067842 Sequence: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR Predict reactive species Full Name: cyclin-dependent kinase inhibitor 1C (p57, Kip2) Calculated Molecular Weight: 316 aa, 32 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC067842 Gene Symbol: p57 Kip2/CDKN1C Gene ID (NCBI): 1028 RRID: AB_2882138 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P49918 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924