Iright
BRAND / VENDOR: Proteintech

Proteintech, 66797-1-Ig, SOCS3 Monoclonal antibody

CATALOG NUMBER: 66797-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SOCS3 (66797-1-Ig) by Proteintech is a Monoclonal antibody targeting SOCS3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 66797-1-Ig targets SOCS3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Daudi cells, Jurkat cells, Ramos cells, CTLL-2 cells, pig spleen tissue Positive IHC detected in: human breast cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Background Information Suppressor of cytokine signaling 3 (SOCS3) is a member of SOCS family that these proteins induced to attenuate cytokine signal transduction in response to signals from a diverse range of cytokines and growth factors. SOCS3 is a negative regulatory protein that inhibits signaling induced by IL-6 via preventing JAK mediated activation of STAT3. However SOCS3 can positively regulate the ERK-MAPK pathway, inhibit the NF-kB pathway (PMID:26429311,25035930). In addition, SOCS3 brings a great impact on immune responses by inhibiting signaling stimulus, such as LPS, type I and type II IFNs, and IL-12. SOCS3 is widely expressed in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney (PMID: 22961088). Dysregulation of SOCS3 functions can cause a variety of diseases, including allergy, autoimmune diseases, inflammation and cancer (PMID:26429311). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5386 Product name: Recombinant human SOCS3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC060858 Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL Predict reactive species Full Name: suppressor of cytokine signaling 3 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC060858 Gene Symbol: SOCS3 Gene ID (NCBI): 9021 RRID: AB_2882141 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O14543 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924