Proteintech, 66805-1-Ig, AQP1 Monoclonal antibody

Size: 20ul / 150ul The AQP1 (66805-1-Ig) by Proteintech is a Monoclonal antibody targeting AQP1 in WB, IHC, IF-P, ELISA applications with reactivity to Human, pig samples 66805-1-Ig targets AQP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, pig samples. Tested Applications Positive WB detected in: human heart tissue, human skeletal muscle tissue, pig kidney tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information AQP1 is a member of aquaporins (AQPs) that are small membrane-spanning proteins facilitating water transport. AQP1 is expressed in most tissues in the mammalian body. Alterations of AQP1 expression have been linked to variety of diseases, including cancer. The predicted molecular weight of AQP1 is around 28 kDa, while highly glycosylated form can also be observed around 40-45 kDa. (1530176) Specification Tested Reactivity: Human, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14093 Product name: Recombinant human AQP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-269 aa of BC022486 Sequence: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK Predict reactive species Full Name: aquaporin 1 (Colton blood group) Calculated Molecular Weight: 269 aa, 29 kDa Observed Molecular Weight: 28 kDa, 38-40 kDa GenBank Accession Number: BC022486 Gene Symbol: AQP1 Gene ID (NCBI): 358 RRID: AB_2882148 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P29972 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.