Iright
BRAND / VENDOR: Proteintech

Proteintech, 66815-1-Ig, RARS Monoclonal antibody

CATALOG NUMBER: 66815-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RARS (66815-1-Ig) by Proteintech is a Monoclonal antibody targeting RARS in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66815-1-Ig targets RARS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, MCF-7 cells, A431 cells, HEK-293 cells, HepG2 cells, NIH/3T3 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:3000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information RARS, also named ArgRS (arginyl-tRNA synthetase), belongs to the class-I aminoacyl-tRNA synthetase family which catalyze the aminoacylation of tRNA by their cognate amino acid. In higher eukaryotes, one of the two arginyl-tRNA synthetases (ArgRSs) has evolved to have an extended N-terminal domain that plays a crucial role in protein synthesis and cell growth and in integration into the multisynthetase complex (MSC) (PMID:25288775). RARS has two isoforms with the molecular weight of 75 and 67 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26399 Product name: Recombinant human RARS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-190 aa of BC000528 Sequence: MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGE Predict reactive species Full Name: arginyl-tRNA synthetase Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC000528 Gene Symbol: RARS Gene ID (NCBI): 5917 RRID: AB_2882158 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P54136 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924