Iright
BRAND / VENDOR: Proteintech

Proteintech, 66830-1-Ig, APOE Monoclonal antibody

CATALOG NUMBER: 66830-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The APOE (66830-1-Ig) by Proteintech is a Monoclonal antibody targeting APOE in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 66830-1-Ig targets APOE in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue, human blood, human plasma, T-47D cells, HepG2 cells, Caco-2 cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:3000-1:20000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information The apolipoprotein E (APOE) is a 299-amino acid polypeptide that mediates the binding, internalization, and catabolism of lipoprotein particles, and also serve as a ligand for the LDL (APO B/E) receptor and for the specific APOE receptor (chylomicron remnant) of hepatic tissues. The very strong association of the APOE ɛ4 allele with AD risk and its role in the accumulation of amyloid β in brains of people and animal models solidify the biological relevance of APOE isoforms but do not provide mechanistic insight. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28186 Product name: Recombinant human APOE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 66-317 aa of BC003557 Sequence: QEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH Predict reactive species Full Name: Apolipoprotein E Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 34-36 kDa GenBank Accession Number: BC003557 Gene Symbol: APOE Gene ID (NCBI): 348 RRID: AB_2882173 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02649 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924