Iright
BRAND / VENDOR: Proteintech

Proteintech, 66837-1-Ig, MBNL1 Monoclonal antibody

CATALOG NUMBER: 66837-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MBNL1 (66837-1-Ig) by Proteintech is a Monoclonal antibody targeting MBNL1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 66837-1-Ig targets MBNL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HeLa cells, rat heart tissue, Jurkat cells, HEK-293 cells, C2C12 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MBNL1 (muscleblind-like 1) is one of the MBNL proteins containing 3 members (MBNL1-3) in vertebrates. And MBNL1 is widely expressed in adult tissues including brain, heart and skeletal muscle (PMID:25274774). As a highly conserved RNA-binding protein, MBNL1 regulates alternative splicing, alternative polyadenylation, mRNA stability and mRNA localization in the nucleus. The neurological diseases DM1 and DM2 (myotonic dystrophy type 1 and type2) are caused by expansion of repetitive sequences in non-coding regions in the DMPK gene because of the inappropriate patterns of alternative splicing owing to MBNL1(PMID:24354850). The antibody could recognize the common full-length protein in applications. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7752 Product name: Recombinant human MBNL1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-343 aa of BC050535 Sequence: MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM Predict reactive species Full Name: muscleblind-like (Drosophila) Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC050535 Gene Symbol: MBNL1 Gene ID (NCBI): 4154 RRID: AB_2882180 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NR56 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924