Iright
BRAND / VENDOR: Proteintech

Proteintech, 66855-1-Ig, CD126/IL-6R alpha Monoclonal antibody

CATALOG NUMBER: 66855-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD126/IL-6R alpha (66855-1-Ig) by Proteintech is a Monoclonal antibody targeting CD126/IL-6R alpha in WB, IHC, ELISA applications with reactivity to human samples 66855-1-Ig targets CD126/IL-6R alpha in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human spleen tissue, Human peripheral blood leukocyte Positive IHC detected in: human liver cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Interleukin-6 (IL-6) is a pleiotropic cytokine produced by a variety of cells during infection, trauma, and immunological challenge (PMID: 8274730). IL-6 acts via a receptor complex consisting of two distinct membrane-bound glycoproteins, an 80-kDa IL-6-binding subunit (IL-6R alpha, CD126, gp80) and a 130-kDa signal-transducing element (gp130, CD130). After binding of IL-6 to membrane-bound IL-6R alpha, the complex of IL-6 and IL-6R alpha associates with gp130, thus activating the receptor (PMID: 9716487). Expression of gp130 is found in almost all organs while expression of IL-6R alpha is predominantly confined to hepatocytes and leukocyte subpopulations (monocytes, neutrophils, T cells, and B cells) (PMID: 11149892). Soluble form of IL-6R alpha has been found in human serum and urine (PMID: 2529343; 1545125). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18263 Product name: Recombinant human IL-6R protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-371 aa of BC132684 Sequence: PRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAG Predict reactive species Full Name: interleukin 6 receptor Calculated Molecular Weight: 468 aa, 52 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC132684 Gene Symbol: IL-6R alpha Gene ID (NCBI): 3570 RRID: AB_2882195 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P08887 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924