Iright
BRAND / VENDOR: Proteintech

Proteintech, 66889-1-Ig, GLUT2 Monoclonal antibody

CATALOG NUMBER: 66889-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLUT2 (66889-1-Ig) by Proteintech is a Monoclonal antibody targeting GLUT2 in WB, IHC, ELISA applications with reactivity to Human, rat, mouse samples 66889-1-Ig targets GLUT2 in WB, IHC, IF, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: 4T1 cells, HSC-T6 cells, HeLa cells, HepG2 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information GLUT2 is a member of glucose transporters or GLUTs which catalyze the glucose transport across plasma membrane. GLUT2 is selectively expressed in hepatocytes, pancreatic beta cells, and absorptive renal and intestinal epithelial cells. GLUT2 is required to maintain normal glucose homeostasis and normal function and development of the endocrine pancreas. Its absence leads to symptoms characteristic of non-insulin-dependent diabetes mellitus. Specification Tested Reactivity: Human, rat, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14551 Product name: Recombinant human SLC2A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 69-128 aa of BC060041 Sequence: SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR Predict reactive species Full Name: solute carrier family 2 (facilitated glucose transporter), member 2 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC060041 Gene Symbol: GLUT2 Gene ID (NCBI): 6514 RRID: AB_2918478 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P11168 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924