Iright
BRAND / VENDOR: Proteintech

Proteintech, 66890-1-Ig, Jagged1/CD339 Monoclonal antibody

CATALOG NUMBER: 66890-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Jagged1/CD339 (66890-1-Ig) by Proteintech is a Monoclonal antibody targeting Jagged1/CD339 in WB, ELISA applications with reactivity to human samples 66890-1-Ig targets Jagged1/CD339 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HT-29 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Jagged1 is a type I, membrane- anchored, multidomain protein and a ligand of the Notch receptor. The receptor-ligand interaction can trigger the Notch signaling and activate transcription factors that play key roles in cell differentiation and morphogenesis. The predicted MW of Jagged1 is 134 kDa, while higher MW around 150-180 kDa had been observed in literations (PMID: 9716576, 9596653). Specification Tested Reactivity: human Cited Reactivity: human, goat Host / Isotype: Mouse / IgA Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11891 Product name: Recombinant human Jagged1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-350 aa of BC098393 Sequence: FELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGS Predict reactive species Full Name: jagged 1 (Alagille syndrome) Calculated Molecular Weight: 1218 aa, 134 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC098393 Gene Symbol: Jagged1 Gene ID (NCBI): 182 RRID: AB_2882220 Conjugate: Unconjugated Form: Liquid Purification Method: Thiophilic affinity chromatograph UNIPROT ID: P78504 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924