Iright
BRAND / VENDOR: Proteintech

Proteintech, 66923-1-Ig, ROR1 Monoclonal antibody

CATALOG NUMBER: 66923-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ROR1 (66923-1-Ig) by Proteintech is a Monoclonal antibody targeting ROR1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 66923-1-Ig targets ROR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, NIH/3T3 cells, HepG2 cells, K-562 cells, NCI-H1299 cells, HEK-293 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information ROR1 is a member of the RTK family of orphan receptors related to muscle-specific kinase and Trk neurotrophin receptors (PMID: 18546292). ROR1 is primarily expressed by neural crest cells during embryogenesis. High expression of ROR1 is reported in many types of malignancies and is thought to be involved in tumor growth, apoptosis, and epithelial-mesenchymal transition (PMID: 26245996). The human ROR1 gene encodes a 937 amino acid protein with an Ig-like domain, a cysteine-rich domain, a kringle domain, a tyrosine kinase domain, and a proline-rich domain. The calculated molecular weight of ROR1 is 104 kDa, but ROR1 has multiple N-glycosylation sites that generate post-translationally modified ROR1 at 130 kDa (PMID: 24752542). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14586 Product name: Recombinant human ROR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-364 aa of BC006374 Sequence: DECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRN Predict reactive species Full Name: receptor tyrosine kinase-like orphan receptor 1 Calculated Molecular Weight: 937 aa, 104 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC006374 Gene Symbol: ROR1 Gene ID (NCBI): 4919 RRID: AB_2882250 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q01973 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924