Iright
BRAND / VENDOR: Proteintech

Proteintech, 66930-1-Ig, MMP12 Monoclonal antibody

CATALOG NUMBER: 66930-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MMP12 (66930-1-Ig) by Proteintech is a Monoclonal antibody targeting MMP12 in WB, ELISA applications with reactivity to Human samples 66930-1-Ig targets MMP12 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells, NCI-H1299 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Background Information MMP12(Matrix metalloproteinase-12) is a 54 kDa proenzyme that is processed into a 45 kDa and then a 22 kDa active form(15723202). MMP9 and MMP12 promote intimal thickening by independent cleavage of N-cadherin, which elevates vascular smooth muscle cell proliferation via beta-catenin signalling. Its overexpression in myeloid lineage cells plays a key role in modulating myelopoiesis, immune suppression, and lung tumorigenesis(PMID: 21378275). Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19068 Product name: Recombinant human MMP12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 231-402 aa of BC112301 Sequence: DPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWR Predict reactive species Full Name: matrix metallopeptidase 12 (macrophage elastase) Calculated Molecular Weight: 470 aa, 54 kDa Observed Molecular Weight: 54 kDa, 45 kDa GenBank Accession Number: BC112301 Gene Symbol: MMP12 Gene ID (NCBI): 4321 RRID: AB_2882256 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P39900 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924