Proteintech, 66938-1-Ig, ZFP36 Monoclonal antibody

Size: 20ul / 150ul The ZFP36 (66938-1-Ig) by Proteintech is a Monoclonal antibody targeting ZFP36 in WB, IHC, ELISA applications with reactivity to human, mouse, pig samples 66938-1-Ig targets ZFP36 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: HepG2 cells, A549 cells, NCI-H1299 cells, LPS treated U-937 cells, 3T3-L1 cells, pig lung tissue, RAW 264.7 cells Positive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information The expression of many cytokines is regulated post-transcriptionally by factors that modulate mRNA transport, translation, and stability. Much of this regulation occurs by the binding and stabilizing, or destabilizing, of cytokine mRNAs by proteins that recognize adenosine and uridine-rich elements (AREs) in untranslated regions of target transcripts. Zfp36 is a mRNA-binding protein involved in post-transcriptional regulation of AU-rich element (ARE)-containing mRNAs. It was demonstrated to physically interact with the p65 subunit of nuclear factor-κB leading to decreased nuclear import and diminished transcriptional activation mediated by nuclear factor-κB. It acted by specifically binding ARE-containing mRNAs and promoting their degradation, and has a crucial role in the post-transcriptional regulation of tumor necrosis factor (TNF). Specification Tested Reactivity: human, mouse, pig Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28473 Product name: Recombinant human ZFP36 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-326 aa of BC009693 Sequence: MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE Predict reactive species Full Name: zinc finger protein 36, C3H type, homolog (mouse) Calculated Molecular Weight: 326 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC009693 Gene Symbol: ZFP36 Gene ID (NCBI): 7538 RRID: AB_2882262 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26651 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.