Iright
BRAND / VENDOR: Proteintech

Proteintech, 66940-1-Ig, RACK1; GNB2L1 Monoclonal antibody

CATALOG NUMBER: 66940-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RACK1; GNB2L1 (66940-1-Ig) by Proteintech is a Monoclonal antibody targeting RACK1; GNB2L1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples 66940-1-Ig targets RACK1; GNB2L1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples. Tested Applications Positive WB detected in: HeLa cells, pig liver tissue, NIH/3T3 cells, HSC-T6 cells, HepG2 cells, T-47D cells, L02 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Members of the protein kinase C (PKC) family play a key regulatory role in a variety of cellular functions, including cell growth and differentiation, gene expression, hormone secretion and membrane function. RACK1 (receptor for activated protein kinase C 1), encoded by GNB2L1 gene, is a 317 amino acid guanine nucleotide-binding protein subunit beta-2-like 1 protein which is involved in the recruitment, assembly and/or regulation of a variety of signaling molecules, it contains 7 WD-repeats and is implicated in various protein interaction activities. RACK1 is a component of the 40S ribosomal subunit involved in translational repression. Recent finding suggests that RACK1 may be a new promising diagnosis biomarker and therapeutic target for non-small-cell lung cancer (NSCLC). Specification Tested Reactivity: Human, Mouse, Rat, Pig Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26708 Product name: Recombinant human RACK1; GNB2L1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 131-317 aa of BC019093 Sequence: LWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR Predict reactive species Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC019093 Gene Symbol: RACK1 Gene ID (NCBI): 10399 RRID: AB_2882264 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P63244 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924