Iright
BRAND / VENDOR: Proteintech

Proteintech, 66953-1-Ig, BLNK Monoclonal antibody

CATALOG NUMBER: 66953-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BLNK (66953-1-Ig) by Proteintech is a Monoclonal antibody targeting BLNK in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, pig, mouse, rat samples 66953-1-Ig targets BLNK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, pig, mouse, rat samples. Tested Applications Positive WB detected in: human spleen tissue, Raji cells, Daudi cells, Ramos cells, pig spleen tissue Positive IHC detected in: human appendicitis tissue, mouse thymus tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Raji cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:3000-1:8000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information BLNK (also known as SLP-65 or BASH) is an important adaptor protein selectively expressed in B-lineage cells. BLNK bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. BLNK has been shown to be necessary for BCR-mediated Ca2+ mobilization, for the activation of mitogen-activated protein kinases such as ERK, JNK, and p38 in a chicken B cell line DT40, and for activation of transcription factors such as NF-AT and NF-κB in human or mouse B cells. BLNK plays a crucial role in pre-BCR-dependent progression of B cell development, BCR-mediated B cell survival, activation, proliferation, and T-independent immune responses. Specification Tested Reactivity: Human, pig, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28673 Product name: Recombinant human BLNK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-456 aa of BC018906 Sequence: MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS Predict reactive species Full Name: B-cell linker Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC018906 Gene Symbol: BLNK Gene ID (NCBI): 29760 RRID: AB_2882276 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8WV28 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924