Proteintech, 66954-1-Ig, FGFR3 Monoclonal antibody

Size: 20ul / 150ul The FGFR3 (66954-1-Ig) by Proteintech is a Monoclonal antibody targeting FGFR3 in WB, IF/ICC, ELISA applications with reactivity to human samples 66954-1-Ig targets FGFR3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, L02 cells, L-929 cells, HeLa cells, HEK-293 cells, HepG2 cells, A549 cells, NCI-H1299 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Fibroblast growth factors (FGFs) are polypeptide growth factors involved in a variety of activities including mitogenesis, angiogenesis, and wound healing (PMID: 1847508). The human FGF receptor family, a subfamily of receptor tyrosine kinases (RTKs), comprises of four family members-FGFR1, FGFR2, FGFR3, and FGFR4 (PMID: 23900974). Each receptor contains an extracellular domain with either two or three immunoglobulin-like domains, a transmembrane domain, and a cytoplasmic tyrosine kinase domain. FGFR3 binds acidic and basic fibroblast GH and plays a role in bone development and maintenance. Mutations in the FGFR3 gene lead to craniosynostosis and multiple types of skeletal dysplasia. Due to frequent mutations in certain cancers, the FGFR3 gene has also been associated with tumor progression. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26290 Product name: Recombinant human FGFR3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 23-125 aa of NM_000142 Sequence: MESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRV Predict reactive species Full Name: fibroblast growth factor receptor 3 Calculated Molecular Weight: 87 kDa Observed Molecular Weight: 125-135 kDa GenBank Accession Number: NM_000142 Gene Symbol: FGFR3 Gene ID (NCBI): 2261 RRID: AB_2882277 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P22607 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.