Proteintech, 66979-1-Ig, FTCD Monoclonal antibody

Size: 20ul / 150ul The FTCD (66979-1-Ig) by Proteintech is a Monoclonal antibody targeting FTCD in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 66979-1-Ig targets FTCD in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse liver tissue, pig kidney tissue, pig liver tissue, rat liver tissue Positive IHC detected in: human kidney tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:3000-1:10000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information FTCD (formimidoyltransferase cyclodeaminase) is critical for the catabolism of histidine. This process is one-carbon units that can enter the one-carbon/folate cycle, which provides methyl groups for arsenic metabolism (PMID: 30893314). In addition, FTCD could serve as a predictive and prognostic marker for patients with HCC (PMID: 37675273). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17429 Product name: Recombinant human FTCD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 192-541 aa of BC136395 Sequence: TKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE Predict reactive species Full Name: formiminotransferase cyclodeaminase Calculated Molecular Weight: 541 aa, 59 kDa Observed Molecular Weight: 53-62 kDa GenBank Accession Number: BC136395 Gene Symbol: FTCD Gene ID (NCBI): 10841 RRID: AB_2882299 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95954 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.