Iright
BRAND / VENDOR: Proteintech

Proteintech, 66990-1-Ig, TP73 Monoclonal antibody

CATALOG NUMBER: 66990-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TP73 (66990-1-Ig) by Proteintech is a Monoclonal antibody targeting TP73 in WB, ELISA applications with reactivity to human, mouse, rat samples 66990-1-Ig targets TP73 in WB, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26793 Product name: Recombinant human TP73 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_001126240 Sequence: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYA Predict reactive species Full Name: tumor protein p73 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001126240 Gene Symbol: TP73 Gene ID (NCBI): 7161 RRID: AB_2882307 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O15350 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924