Proteintech, 67009-1-Ig, KIF5A Monoclonal antibody

Size: 20ul / 150ul The KIF5A (67009-1-Ig) by Proteintech is a Monoclonal antibody targeting KIF5A in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat, pig samples 67009-1-Ig targets KIF5A in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples. Tested Applications Positive WB detected in: rat brain tissue, pig brain tissue, rat cerebellum tissue, mouse brain tissue Positive IF/ICC detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Kinesin superfamily proteins (KIFs) are microtubule-based molecular motors essential for the intracellular transport of various cargos, including organelles, proteins, and RNAs. KIF5A is expressed exclusively in neurons and transports neuronal cargoes into axons and dendrites. KIF5A mutations have been associated with Charcot-Marie-Tooth Type 2, an axonal peripheral neuropathy characterized by progressive loss of peripheral sensation and muscle wasting. Specification Tested Reactivity: Human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15682 Product name: Recombinant human KIF5A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 931-1032 aa of BC146670 Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS Predict reactive species Full Name: kinesin family member 5A Calculated Molecular Weight: 1032 aa, 117 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC146670 Gene Symbol: KIF5A Gene ID (NCBI): 3798 RRID: AB_2882326 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q12840 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.