Iright
BRAND / VENDOR: Proteintech

Proteintech, 67010-1-Ig, RASGRF1 Monoclonal antibody

CATALOG NUMBER: 67010-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RASGRF1 (67010-1-Ig) by Proteintech is a Monoclonal antibody targeting RASGRF1 in WB, ELISA applications with reactivity to rat, pig samples 67010-1-Ig targets RASGRF1 in WB, ELISA applications and shows reactivity with rat, pig samples. Tested Applications Positive WB detected in: pig cerebellum tissue, pig brain tissue, rat brain tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information RasGRF1, a member of calmodulin-activated guanine-nucleotide exchange factors (GEFs), highly expressed at the synaptic junctions of the central nervous system (CNS). It is similar to the Saccharomyces cerevisiae CDC25. RASGRF1 serves as an in vivo activator for H-RAS and members of the R-RAS and RAC subfamilies. Several studies have shown that RasGRF1 also binds to microtubules and participate in the regulation of neurite outgrowth. RasGRF1 has been implicated in neuronal excitability. The studies of the similar gene in mouse suggested that the Ras-GEF activity of this protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated that the Ras-GEF signaling pathway mediated by this protein may be important for long-term memory. Specification Tested Reactivity: rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6937 Product name: Recombinant human RASGRF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 832-1181 aa of BC040275 Sequence: QSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQVRAGGWHHCLPGAGLGLGQEDPWAGHWASTSGQRTGLRSNTPR Predict reactive species Full Name: Ras protein-specific guanine nucleotide-releasing factor 1 Calculated Molecular Weight: 134 kDa Observed Molecular Weight: 145 kDa GenBank Accession Number: BC040275 Gene Symbol: RASGRF1 Gene ID (NCBI): 5923 RRID: AB_2882327 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13972 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924