Iright
BRAND / VENDOR: Proteintech

Proteintech, 67023-1-Ig, Frizzled 9 Monoclonal antibody

CATALOG NUMBER: 67023-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Frizzled 9 (67023-1-Ig) by Proteintech is a Monoclonal antibody targeting Frizzled 9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 67023-1-Ig targets Frizzled 9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, A549 cells, fetal human brain tissue, HeLa cells, NCI-H1299 cells Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4971 Product name: Recombinant human FZD9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 23-247 aa of BC026333 Sequence: LEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENREKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTA Predict reactive species Full Name: frizzled homolog 9 (Drosophila) Calculated Molecular Weight: 591 aa, 64 kDa Observed Molecular Weight: 64-70 kDa GenBank Accession Number: BC026333 Gene Symbol: Frizzled 9 Gene ID (NCBI): 8326 RRID: AB_2882338 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O00144 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924