Iright
BRAND / VENDOR: Proteintech

Proteintech, 67048-1-Ig, Cyclin D2 Monoclonal antibody

CATALOG NUMBER: 67048-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Cyclin D2 (67048-1-Ig) by Proteintech is a Monoclonal antibody targeting Cyclin D2 in WB, ELISA applications with reactivity to Human, mouse samples 67048-1-Ig targets Cyclin D2 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, NIH/3T3 cells, U2OS cells, MCF-7 cells, Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information CCND2 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. CCND2 forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. CCND2 has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. High level expression of CCND2 was observed in ovarian and testicular tumors. Specification Tested Reactivity: Human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25190 Product name: Recombinant human CCND2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-289 aa of BC010958 Sequence: MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL Predict reactive species Full Name: cyclin D2 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC010958 Gene Symbol: Cyclin D2 Gene ID (NCBI): 894 RRID: AB_2882361 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30279 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924