Iright
BRAND / VENDOR: Proteintech

Proteintech, 67070-1-Ig, PPP1CA Monoclonal antibody

CATALOG NUMBER: 67070-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP1CA (67070-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP1CA in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit, zebrafish samples 67070-1-Ig targets PPP1CA in WB, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, zebrafish samples. Tested Applications Positive WB detected in: HeLa cells, fetal human brain tissue, pig brain tissue, zebrafish tissue, T-47D cells, Jurkat cells, HEK-293 cells, rabbit brain tissue, rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Protein phosphatase associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Type 1 protein phosphatase (PP1), a serine/threonine phosphatase, is essential for cell division and participates in the regulation of glycogen metabolism, muscle contractility, and protein synthesis. Four isoforms of PP1 have been characterized: PP1α, PP1δ, PP1γ1 and PP1γ2 (PMID: 9835651). It has been illustrated that PP1 dephosphorylates Rb and cdc25 during mitosis (PMID: 8384581, PMID: 1392080). A cell cycle-dependent phosphorylation at Thr320 of PP1α by cdc2 kinase inhibits PP1α activity (PMID: 9122166). Specification Tested Reactivity: human, mouse, rat, pig, rabbit, zebrafish Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28451 Product name: Recombinant human PPP1CA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 140-330 aa of BC001888 Sequence: CKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK Predict reactive species Full Name: protein phosphatase 1, catalytic subunit, alpha isoform Calculated Molecular Weight: 330 aa, 38 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC001888 Gene Symbol: PPP1CA Gene ID (NCBI): 5499 RRID: AB_2882379 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P62136 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924