Iright
BRAND / VENDOR: Proteintech

Proteintech, 67073-1-Ig, TRIM40 Monoclonal antibody

CATALOG NUMBER: 67073-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRIM40 (67073-1-Ig) by Proteintech is a Monoclonal antibody targeting TRIM40 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, pig samples 67073-1-Ig targets TRIM40 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: NCCIT cell, THP-1 cells, pig small intestine tissue, HT-29 cells, NCCIT cells, JAR cells Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:600-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21660 Product name: Recombinant human TRIM40 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-258 aa of BC060785 Sequence: MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL Predict reactive species Full Name: tripartite motif-containing 40 Calculated Molecular Weight: 258 aa, 29 kDa Observed Molecular Weight: 26-36 kDa GenBank Accession Number: BC060785 Gene Symbol: TRIM40 Gene ID (NCBI): 135644 RRID: AB_2882382 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6P9F5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924