Iright
BRAND / VENDOR: Proteintech

Proteintech, 67081-1-Ig, FRZB Monoclonal antibody

CATALOG NUMBER: 67081-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FRZB (67081-1-Ig) by Proteintech is a Monoclonal antibody targeting FRZB in WB, ELISA applications with reactivity to Human, mouse samples 67081-1-Ig targets FRZB in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, 4T1 cells, MKN-45 cells, SGC-7901 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Frzb (also known as sFRP3) is a member of the secreted frizzled related protein (SFRP) family, originally identified as a chondrogenic factor during bone morphogenesis (PMID: 29209231). It was subsequently shown to be a regulator in Wnt signaling, and also have a role in regulating cell growth and differentiation in specific cell types. FRZB was seen to be acting as an oncogene in some cancer, such as metastatic renal cancer. Specification Tested Reactivity: Human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28147 Product name: Recombinant human FRZB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 153-325 aa of BC027855 Sequence: IVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN Predict reactive species Full Name: frizzled-related protein Calculated Molecular Weight: 325 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC027855 Gene Symbol: FRZB Gene ID (NCBI): 2487 RRID: AB_2882389 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q92765 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924