Iright
BRAND / VENDOR: Proteintech

Proteintech, 67099-1-Ig, PICK1 Monoclonal antibody

CATALOG NUMBER: 67099-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PICK1 (67099-1-Ig) by Proteintech is a Monoclonal antibody targeting PICK1 in WB, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples 67099-1-Ig targets PICK1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples. Tested Applications Positive WB detected in: HeLa cells, LNCaP cells, MCF-7 cells, pig brain tissue, rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Protein interacting with C kinase 1 (PICK1) was first cloned as a PKC-binding partner through yeast two hybrid system. PICK1 acts as a critical regulator of membrane receptors’ subcellular trafficking to modulate neural processes such as learning and memory, and is widely expressed in brain, testis, heart, lung, liver, kidney and muscle. It probably binds to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence, for instance, PICK1 is a critical mediator of α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) trafficking in neural synapses. PICK1 expression on D-serine release and glutamate transport in astrocytes suggests a potential implication of PICK1 in the progression of amyotrophic lateral sclerosis (ALS). PICK1 may also participate in breast cancer development through inhibition of TGF-β signaling. Specification Tested Reactivity: Human, Mouse, Rat, Pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28609 Product name: Recombinant human PICK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-415 aa of BC017561 Sequence: MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS Predict reactive species Full Name: protein interacting with PRKCA 1 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC017561 Gene Symbol: PICK1 Gene ID (NCBI): 9463 RRID: AB_2882404 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NRD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924