Iright
BRAND / VENDOR: Proteintech

Proteintech, 67102-1-Ig, SAP102 Monoclonal antibody

CATALOG NUMBER: 67102-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SAP102 (67102-1-Ig) by Proteintech is a Monoclonal antibody targeting SAP102 in WB, IHC, ELISA applications with reactivity to Human, Pig, Mouse, Rat samples 67102-1-Ig targets SAP102 in WB, IHC, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples. Tested Applications Positive WB detected in: pig brain tissue, mouse cerebellum tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Synapse-associated protein 102 (SAP102), also known as DLG3, is a MAGUK that is highly expressed early in development and mediates receptor trafficking during synaptogenesis. The importance of SAP102 function in brain development is demonstrated by the fact that SAP102 mutations have been identified in human patients with nonsyndromic X-linked mental retardation (XLMR).SAP102 has critical roles in early cortical synapse development. Specification Tested Reactivity: Human, Pig, Mouse, Rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28589 Product name: Recombinant human DLG3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 466-817 aa of BC093864 Sequence: RPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL Predict reactive species Full Name: discs, large homolog 3 (Drosophila) Calculated Molecular Weight: 817 aa, 90 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC093864 Gene Symbol: SAP102 Gene ID (NCBI): 1741 RRID: AB_2882407 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q92796 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924