Iright
BRAND / VENDOR: Proteintech

Proteintech, 67108-1-Ig, VAV2 Monoclonal antibody

CATALOG NUMBER: 67108-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VAV2 (67108-1-Ig) by Proteintech is a Monoclonal antibody targeting VAV2 in WB, IF/ICC, ELISA applications with reactivity to Human, pig, mouse, rat samples 67108-1-Ig targets VAV2 in WB, IF/ICC, ELISA applications and shows reactivity with Human, pig, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, A431 cells, HeLa cells, HEK-293 cells, pig brain tissue, rat brain tissue, mouse brain tissue Positive IF/ICC detected in: A431 cells, HeLa cells, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: Human, pig, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17988 Product name: Recombinant human VAV2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 98-326 aa of BC132967 Sequence: DLFDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVV Predict reactive species Full Name: vav 2 guanine nucleotide exchange factor Calculated Molecular Weight: 839 aa, 97 kDa Observed Molecular Weight: 101 kDa GenBank Accession Number: BC132967 Gene Symbol: VAV2 Gene ID (NCBI): 7410 RRID: AB_2882412 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P52735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924