Proteintech, 67118-1-Ig, RAB3D Monoclonal antibody

Size: 20ul / 150ul The RAB3D (67118-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB3D in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 67118-1-Ig targets RAB3D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: NCI-H1299 cells, A549 cells, HT-29 cells, THP-1 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16784 Product name: Recombinant human RAB3D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-219 aa of BC016471 Sequence: MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC Predict reactive species Full Name: RAB3D, member RAS oncogene family Calculated Molecular Weight: 219 aa, 24 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC016471 Gene Symbol: RAB3D Gene ID (NCBI): 9545 RRID: AB_2882421 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95716 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.