Iright
BRAND / VENDOR: Proteintech

Proteintech, 67121-1-Ig, PI3 Kinase p110 Beta Monoclonal antibody

CATALOG NUMBER: 67121-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PI3 Kinase p110 Beta (67121-1-Ig) by Proteintech is a Monoclonal antibody targeting PI3 Kinase p110 Beta in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 67121-1-Ig targets PI3 Kinase p110 Beta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, MCF-7 cells, SH-SY5Y cells, PC-12 cells Positive IHC detected in: human lung cancer tissue, human colon cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information PIK3CB(phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform) is also named as PIK3C1, PI3K-beta, p110beta. The gene encodes a 1070 amino acid protein which belongs to the PI3/PI4-kinase family. Phosphoinositide 3-kinases (PI3Ks) have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. The class I PI3 kinases are heterodimers composed of 110 kDa catalytic subunits that associate with regulatory adaptor proteins. Four class I catalytic subunits have been identified, PIK3CA (p110α), PIK3CB (p110β), PIK3CD (p110δ) and PIK3CG (p110γ)(PMID:19177002). Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat, chicken Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17505 Product name: Recombinant human PIK3CB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 139-373 aa of BC114432 Sequence: SLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEV Predict reactive species Full Name: phosphoinositide-3-kinase, catalytic, beta polypeptide Calculated Molecular Weight: 1070 aa, 123 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC114432 Gene Symbol: PI3 Kinase p110 Beta Gene ID (NCBI): 5291 RRID: AB_2882424 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P42338 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924