Iright
BRAND / VENDOR: Proteintech

Proteintech, 67122-1-Ig, mFC tag Monoclonal antibody

CATALOG NUMBER: 67122-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 150ul The mFC tag (67122-1-Ig) by Proteintech is a Monoclonal antibody targeting mFC tag in WB, ELISA applications with reactivity to mouse samples 67122-1-Ig targets mFC tag in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Mouse IgG Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information This antibody detects the mouse Fc tag. It's mouse Fc gamma 2a. Specification Tested Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27844 Product name: Recombinant mouse FC tag protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-232 aa of Sequence: PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK Predict reactive species Full Name: mFC tag Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 25-30 kDa RRID: AB_2918482 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924