Iright
BRAND / VENDOR: Proteintech

Proteintech, 67140-1-Ig, TCF3 Monoclonal antibody

CATALOG NUMBER: 67140-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TCF3 (67140-1-Ig) by Proteintech is a Monoclonal antibody targeting TCF3 in WB, IF/ICC, ELISA applications with reactivity to Human samples 67140-1-Ig targets TCF3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HepG2 cells, NCI-H1299 cells, PC-3 cells, Jurkat cells, K-562 cells, THP-1 cells, A549 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15734 Product name: Recombinant human TCF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 318-480 aa of BC110580 Sequence: WPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTRCQ Predict reactive species Full Name: transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) Calculated Molecular Weight: 654 aa, 68 kDa Observed Molecular Weight: 68-70 kDa GenBank Accession Number: BC110580 Gene Symbol: TCF3 Gene ID (NCBI): 6929 RRID: AB_2882439 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15923 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924