Iright
BRAND / VENDOR: Proteintech

Proteintech, 67150-1-Ig, FXYD1 Monoclonal antibody

CATALOG NUMBER: 67150-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FXYD1 (67150-1-Ig) by Proteintech is a Monoclonal antibody targeting FXYD1 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Pig, mouse samples 67150-1-Ig targets FXYD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Pig, mouse samples. Tested Applications Positive WB detected in: human heart tissue, human skeletal muscle tissue, pig heart tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information FXYD1, also named as PLM and Phospholemman, belongs to the FXYD family. FXYD1 induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. It may have a functional role in muscle contraction. FXYD1 is a partner protein and regulator of the Na+,K+-ATPase (Na+,K+-pump). It may play a role in the acute regulation of the Na+,K+-ATPase response to exercise. (PMID: 20595385, 21653224) Specification Tested Reactivity: Human, Pig, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25307 Product name: Recombinant human FXYD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-92 aa of BC032800 Sequence: MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR Predict reactive species Full Name: FXYD domain containing ion transport regulator 1 Calculated Molecular Weight: 92 aa, 10 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC032800 Gene Symbol: FXYD1 Gene ID (NCBI): 5348 RRID: AB_2882448 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00168 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924