Iright
BRAND / VENDOR: Proteintech

Proteintech, 67172-1-Ig, FBXO32 Monoclonal antibody

CATALOG NUMBER: 67172-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FBXO32 (67172-1-Ig) by Proteintech is a Monoclonal antibody targeting FBXO32 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 67172-1-Ig targets FBXO32 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human heart tissue, pig heart tissue, pig skeletal muscle tissue, Rabbit skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissue, rat skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:15000-1:50000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information FBXO32 (F box only protein 32), also known as Atrogin 1 or MAFbx, is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif F-box. This protein is an E3 ubiquitin ligase that is markedly up-regulated in muscle atrophy. FBXO32 is thus a potential drug target for the treatment of muscle atrophy. Some data support that FBXO32 may play an important role in tumorigenesis. Recent study reveal that FBXO32 targets the oncogenic protein c-Myc for ubiquitination and degradation through the proteasome pathway. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig, canine Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25247 Product name: Recombinant human FBXO32 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-216 aa of BC024030 Sequence: IAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF Predict reactive species Full Name: F-box protein 32 Calculated Molecular Weight: 355 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC024030 Gene Symbol: FBXO32 Gene ID (NCBI): 114907 RRID: AB_2882468 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q969P5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924