Iright
BRAND / VENDOR: Proteintech

Proteintech, 67173-1-Ig, HSPA4 Monoclonal antibody

CATALOG NUMBER: 67173-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSPA4 (67173-1-Ig) by Proteintech is a Monoclonal antibody targeting HSPA4 in WB, ELISA applications with reactivity to human, pig samples 67173-1-Ig targets HSPA4 in WB, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, pig brain tissue, HepG2 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information HSPA4 (also known as Apg-2, HSP70RY) is a 110 kDa cytosolic protein, a member of the heat-shock protein 110 (Hsp 110) subfamily of Hsp70 proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA4 is ubiquitously expressed and its expression is not heat inducible. Overexpression of HSPA4 has been reported in some leukemia and solid tumors. Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16624 Product name: Recombinant human HSPA4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 680-840 aa of BC110861 Sequence: NLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID Predict reactive species Full Name: heat shock 70kDa protein 4 Calculated Molecular Weight: 840 aa, 94 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC110861 Gene Symbol: HSPA4 Gene ID (NCBI): 3308 RRID: AB_2882469 Conjugate: Unconjugated Form: Liquid Purification Method: Caprylic acid/ammonium sulfate precipitation UNIPROT ID: P34932 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924