Proteintech, 67191-1-Ig, NDRG2 Monoclonal antibody

Size: 20ul / 150ul The NDRG2 (67191-1-Ig) by Proteintech is a Monoclonal antibody targeting NDRG2 in WB, IHC, ELISA applications with reactivity to Human, Rat, Mouse, Pig samples 67191-1-Ig targets NDRG2 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Rat, Mouse, Pig samples. Tested Applications Positive WB detected in: human heart tissue, pig brain tissue, rat brain tissue, mouse brain tissue, pig heart tissue, rat heart tissue Positive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Specification Tested Reactivity: Human, Rat, Mouse, Pig Cited Reactivity: mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28612 Product name: Recombinant human NDRG2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-357 aa of BC010458 Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC Predict reactive species Full Name: NDRG family member 2 Calculated Molecular Weight: 371 aa, 39 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC010458 Gene Symbol: NDRG2 Gene ID (NCBI): 57447 RRID: AB_2882486 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UN36 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.