Iright
BRAND / VENDOR: Proteintech

Proteintech, 67197-1-Ig, SIN3A Monoclonal antibody

CATALOG NUMBER: 67197-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SIN3A (67197-1-Ig) by Proteintech is a Monoclonal antibody targeting SIN3A in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 67197-1-Ig targets SIN3A in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, HEK-293 cells, MCF-7 cells, Jurkat cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1250-1:5000 Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28865 Product name: Recombinant human SIN3A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-156 aa of BC066364 Sequence: MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVVFSSFSWVKKFIFSRKYWLQLVGCGGTTSNLRY Predict reactive species Full Name: SIN3 homolog A, transcription regulator (yeast) Calculated Molecular Weight: 145 kDa Observed Molecular Weight: 145-150 kDa GenBank Accession Number: BC066364 Gene Symbol: SIN3A Gene ID (NCBI): 25942 RRID: AB_2882490 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96ST3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924