Iright
BRAND / VENDOR: Proteintech

Proteintech, 67201-1-Ig, PITX2 Monoclonal antibody

CATALOG NUMBER: 67201-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PITX2 (67201-1-Ig) by Proteintech is a Monoclonal antibody targeting PITX2 in WB, ELISA applications with reactivity to human, mouse, rat samples 67201-1-Ig targets PITX2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, HEK-293 cells, mouse brain tissue, rat cerebellum tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information PITX2 belongs to the bicoid class of homeodomain transcription factors, which play essential roles in embryonic development. Various PITX2 isoforms are involved in a wide variety of developmental programs, including left-right signaling. It controls cell proliferation in a tissue-specific manner and is involved in morphogenesis. During embryonic development, PITX2 is involved in the expansion of muscle progenitors. In addition, it may play a role in the proper localization of asymmetric organs such as the heart and stomach. PITX2 can be bound by some other proteins, and are part of a much larger atrial transcriptional complex. This antibody specifically recognizes isoform PTX2C. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27924 Product name: Recombinant human PITX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-286 aa of BC013998 Sequence: MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNS Predict reactive species Full Name: paired-like homeodomain 2 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC013998 Gene Symbol: PITX2 Gene ID (NCBI): 5308 RRID: AB_2882494 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q99697 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924