Proteintech, 67207-1-Ig, FGFR1OP Monoclonal antibody

Size: 20ul / 150ul The FGFR1OP (67207-1-Ig) by Proteintech is a Monoclonal antibody targeting FGFR1OP in WB, IF/ICC, ELISA applications with reactivity to human samples 67207-1-Ig targets FGFR1OP in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cels, K-562 cells, U2OS cells Positive IF/ICC detected in: BT-549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1200-1:4800 Background Information FGFR1OP, also named as FOP, is a centrosomal protein that is involved in the anchoring of microtubules to subcellular structures. Three isoforms have been produced by alternative splicing. A chromosomal aberration involving FGFR1OP may be a cause of stem cell myeloproliferative disorder (MPD). MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma and progresses to acute myeloid leukemia. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28671 Product name: Recombinant human FGFR1OP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-374 aa of BC011902 Sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADY Predict reactive species Full Name: FGFR1 oncogene partner Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC011902 Gene Symbol: FGFR1OP Gene ID (NCBI): 11116 RRID: AB_2882500 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O95684 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.