Iright
BRAND / VENDOR: Proteintech

Proteintech, 67228-1-Ig, MRP1 Monoclonal antibody

CATALOG NUMBER: 67228-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MRP1 (67228-1-Ig) by Proteintech is a Monoclonal antibody targeting MRP1 in WB, IF/ICC, ELISA applications with reactivity to human samples 67228-1-Ig targets MRP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: unboiled HepG2 cells, unboiled A549 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Multidrug resistant-associated protein 1 (MRP1; ABCC1) is a member of the ATP-binding cassette (ABC) transporter protein superfamily, subfamily C. MRP1 is overexpressed in cancers and contributes to the occurrence of multidrug resistance (MDR). Expression of MRP1 has been considered as a negative marker for the outcome of chemotherapy. Recently MRP1 has been reported to play a crucial role in Aβ clearance at the blood-brain barrier. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27048 Product name: Recombinant human ABCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 918-1025 aa of NM_004996 Sequence: SSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGIS Predict reactive species Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 1 Calculated Molecular Weight: 172 kDa Observed Molecular Weight: 180-190 kDa GenBank Accession Number: NM_004996 Gene Symbol: MRP1 Gene ID (NCBI): 4363 RRID: AB_2882516 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P33527 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924