Proteintech, 67247-1-Ig, TMEM230 Monoclonal antibody

Size: 20ul / 150ul The TMEM230 (67247-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM230 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 67247-1-Ig targets TMEM230 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, COLO 320 cells, Caco-2 cells, HT-29 cells, A549 cells, MCF-7 cells, HSC-T6 cells, NIH/3T3 cells, PC-12 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15080 Product name: Recombinant human C20orf30 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-120 aa of BC011990 Sequence: MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD Predict reactive species Full Name: chromosome 20 open reading frame 30 Calculated Molecular Weight: 183 aa, 20 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC011990 Gene Symbol: TMEM230 Gene ID (NCBI): 29058 RRID: AB_2882524 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96A57 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.